About this compound
Tesamorelin is a synthetic 44-amino-acid growth-hormone-releasing-hormone analog (the human GHRH(1-44) sequence with an N-terminal trans-3-hexenoyl group and C-terminal amidation). Supplied as a lyophilized powder; each lot is HPLC-tested and ships with a certificate of analysis. For in-vitro research use only – not for human or veterinary use.
Research Peptide
Tesamorelin
$49.00 $9.80 / mg
Specifications
| CAS Number | 218949-48-5 |
|---|---|
| Molecular formula | C221H366N72O67S |
| Molecular weight | 5135.9 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Form / amount | Lyophilized powder · 5 mg/vial |
| Storage | Store lyophilized at -20 °C; protect from light and moisture. |
- Arrives damaged, defective, or incorrect? We replace the item or refund it — see our Refund Policy.
- We never sell, require, or upsell paid shipping-protection — details on our Shipping Policy.
- Tracked U.S. shipping with cold-pack options where appropriate.
For in-vitro research use only. Not for human or veterinary use. Sold only to qualified researchers 21+.
Related products
-
PT-141
$39.00 $3.90 / mgfrom $3.90 / mgSelect options This product has multiple variants. The options may be chosen on the product page -
Ipamorelin
$39.00 $7.80 / mgfrom $5.90 / mgSelect options This product has multiple variants. The options may be chosen on the product page -
AOD-9604
$49.00 $9.80 / mgfrom $8.90 / mgSelect options This product has multiple variants. The options may be chosen on the product page -
Epitalon
$49.00 $4.90 / mgfrom $1.78 / mgSelect options This product has multiple variants. The options may be chosen on the product page